DPCstruct | MC963
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 212 ± 19 aa |
| Standard deviation of domain lengths | 19.45 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 13.43 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X9Q786 | 2-210 | TTELTSLKGGETTAILQEYCFKKNSPLIDEITVWTDQGTLAVSALKAGDILGELYFNVNLADFGENCPLGNNVVMRAPIVVTDASLQ… |
| A0A6J4TKQ1 | 27-224 | AEYGFTFSTDRPGAAAGLSLFVVYRDPTDPEGKAPALTKAAFGLPPGTRIDTRAVPRCTATDEELRARGRDACPSASRVGQGTLVAT… |
| A0A284VP01 | 32-211 | None |
| A0A2N0M567 | 151-368 | None |
| D3FDI8 | 1-233 | None |
| A0A370HDN7 | 33-239 | None |
| A0A1Q3NI05 | 27-274 | None |
| A0A1H6FP34 | 40-275 | None |
| A0A849BY36 | 1-205 | None |
| A0A7C7IAJ9 | 163-381 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.