DPCstruct | MC9629
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 249 ± 27 aa |
| Standard deviation of domain lengths | 27.41 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 20.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C5CA23 | 279-539 | LRPNPVLKIVNDLLDITEKKDITEIEKLMITKPDGTTIRNDVIDMKANYFLSTFQIEKALEIYKQMPDETYWDKYGLFNPFAERIND… |
| A0A3D4M2X6 | 39-255 | ISLSQIGEWKGDALLAMHRFEEAAIAYKGIGRSQFLITDPFLIHVVDCHDCDHRDVLGTLSRLQFAEKMHALNSKAQNGDAQAALEY… |
| A0A4Q3RMQ1 | 6-240 | None |
| A0A3D0QRJ0 | 75-338 | None |
| A0A2X2L1H4 | 871-1143 | None |
| A0A344LTX3 | 241-522 | None |
| A0A7C5NRZ7 | 533-759 | None |
| A0A7X7C1H9 | 5-210 | None |
| A0A519W7I3 | 42-306 | None |
| A0A3C2EH37 | 333-595 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.