DPCstruct | MC9627
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 97 ± 8 aa |
| Standard deviation of domain lengths | 7.52 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 89.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 36.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0080 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H3J4T7 | 159-254 | IGTSKTFISSAGVLRSFCGRCGATVFYSCDERRPNDRENVVDVAIGILRAPEGVKAENWLIWRTGRIANYESGLRYDEALATSLSES… |
| A0A4Q4VD58 | 36-131 | GTLTFHSSSPDVQRYFCSRCSACVFYCVDDRPDMLDVALGLLEAPSGARAEEVVSWTFTGSMGWRQDVVGGWREGHIVAVESTAEAW… |
| A0A2I0RL60 | 178-268 | None |
| A0A4V1XE91 | 213-316 | None |
| A0A3L6NI84 | 108-205 | None |
| A0A6V8HGC9 | 159-250 | None |
| A0A4V1XSD7 | 109-203 | None |
| A0A1Y2DZY2 | 177-270 | None |
| U1GEA7 | 252-340 | None |
| A0A2C5ZNP4 | 13-112 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.