DPCstruct | MC9625
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 118 ± 10 aa |
| Standard deviation of domain lengths | 9.66 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 92.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 41.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0323 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A397GWD4 | 1009-1127 | DGGEDGQNIPLHPLIQPTRHVDVIFAVDSSADTEYNWPNGSSLVATYERSLNSSGIGNGTVFPAVPDVNTFINLGLNTRPTFFGCDP… |
| A0A2S7PNI1 | 68-189 | LDLVDGGEDLQNIPLYPLIQPIREVDVIFAVDSSADTTYHWPNGTALVATYERSLNATIENGTAFPAIPDVNTFVNLGLNHRPTFFG… |
| A0A5B0LP40 | 133-255 | None |
| A0A1B7SQW8 | 158-283 | None |
| A0A6A6PT24 | 209-307 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.