DPCstruct | MC9623
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 354 ± 54 aa |
| Standard deviation of domain lengths | 53.53 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 73.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 28.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A5YVF5 | 552-877 | RKRTTSDPPSRTSNHPSTITPPPTLMPTTKSHRSSSTSSDEVCNLNKRANALGITGKYSNTFLETTCVGGGQTLTHTYVITTISYAA… |
| A0A4Q4TK00 | 1-342 | MATTGAQMASYLYPKEEDLEGAFSFTPPKNIPKGSGRKGNGANPIDRSKPKAGTGSGPNGTGGVTKKKKCRIPKNQETKRMGEARNT… |
| A0A6A5ZNU2 | 227-467 | None |
| A0A1Z5SSM8 | 11-338 | None |
| A0A2V1DA37 | 488-914 | None |
| X0H222 | 152-590 | None |
| A0A3M2RA98 | 470-822 | None |
| A0A135TJ99 | 222-571 | None |
| A0A430L1K2 | 1-383 | None |
| E9F3K9 | 237-679 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.