DPCstruct | MC9622
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 77 ± 10 aa |
| Standard deviation of domain lengths | 10.17 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 66.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 52.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A699TNP5 | 90-152 | MGMLTVRVRRFLQRTGRNLRANGPTSIGFNMSKVECYNCHRKGHFARECRSPKDTRRNVPVEP |
| A0A6L2KQX4 | 8-81 | AMITMRVKKFMKKTGRNLNFNGKERFGFDKTRVECYNCYIRGHFSRECHVPRNQGNRSGDNERRVVPVETPASA |
| A0A6L2P100 | 51-141 | None |
| A0A699UZV3 | 1-81 | None |
| A0A6L2J1C9 | 2-85 | None |
| A0A6L2J1L5 | 1-80 | None |
| A0A6L2NKT5 | 54-142 | None |
| A0A6L2JCP1 | 4-65 | None |
| A0A6L2JFD8 | 9-75 | None |
| A0A6L2JHF1 | 74-141 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.