DPCstruct | MC9620
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 188 ± 17 aa |
| Standard deviation of domain lengths | 17.27 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 71.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 28.74 |
| Pfam Score | 66.67 |
| Assigned Pfam label(s) | PF01693- CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A445DG81 | 1-182 | MKGVYDDWAKAAPFTHQPKTIHKGGFLSIEEAKESLKEYEVLHPEQILKRADKAPAQAQRTPVQVRTGMLKNIPTRAEINDKKRVCR… |
| A0A6L2KKL0 | 30-203 | RGIYNDWAIASTHIIGKSVSCKSYITKEAAEKALRESYKKVTMEEVQKSQQFVSLNQHLQSQTSKLNAINRMKNIPTTSEREERRKP… |
| A0A2U1QGC7 | 856-1021 | None |
| A0A5N6PI39 | 119-302 | None |
| A0A2U1M3H6 | 349-527 | None |
| A0A445B566 | 1-166 | None |
| A0A2U1PM36 | 405-601 | None |
| A0A6L2NVD9 | 55-232 | None |
| A0A445BUT5 | 1-184 | None |
| A0A699I229 | 103-277 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.