DPCstruct | MC962
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 147 ± 10 aa |
| Standard deviation of domain lengths | 9.79 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 70.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 25.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7K1FFB8 | 18-183 | RPDTEEIARSVRSRLLRRRGGIRLLTTSAAAVVVAATVILIALAFRPVRFDPAAPPEITSSSARCYATADLTPEHNFLSVTLVDKAG… |
| A0A1E8CPN8 | 2-153 | SADRTRQLRAAIMAETRISNGRGRRPLAVAAVATTSVLVVGGTAAAWVAVSRPDDPNNAYCSSEASTDRDVWALHGVGTAVNADTGK… |
| A0A4R4TYF0 | 5-167 | None |
| A0A1M3LU14 | 11-149 | None |
| A0A2W6AVQ5 | 33-173 | None |
| I8QSG2 | 1-131 | None |
| A0A7K1L7D3 | 8-150 | None |
| A0A077LZZ5 | 83-229 | None |
| A0A4S2DB81 | 2-145 | None |
| A0A7Y5XDJ6 | 30-172 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.