DPCstruct | MC9619
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 142 ± 14 aa |
| Standard deviation of domain lengths | 14.08 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 39.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0V0QSE6 | 1-154 | MGHLLDSETYIGGKVECLRSGVYRSDFLEKFQYQRSSYQSLIDNVDDLMEFILRVECQRKKTEVKNFEEVREDIIKKLTDLRDVPNP… |
| A0A7N6A2D8 | 165-299 | GHVLDSETYVGGHVEALESGVFRSDIPCRFKMNPAAFDFLLQRVERTMRHAIEEEEKIPLEQVTNFNEVCDEIKKKLTSLKEVPNRI… |
| A0A817GVK0 | 2-161 | None |
| U6KLW3 | 561-673 | None |
| A0A836DCE8 | 421-567 | None |
| A0A287F516 | 67-209 | None |
| A0A1I7WRX4 | 31-170 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.