DPCstruct | MC9617
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 232 ± 37 aa |
| Standard deviation of domain lengths | 37.19 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 81.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 29.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7F8RK94 | 79-347 | HQEYYRGRNNLTAPVSKTIFHDITRLHLDDGLINCAKYFINYFFYKFGLETCFLMSVNVIGQRMDFYAMIHACWLIAVLYRRRRKAI… |
| A0A3P7SNC0 | 30-197 | TLLGTLLVIQYAACSQIPSILVESLPWDSTDNETIRLQQWLYLPSTSYQPDPRKLIVDFLQFMLVAAQWRVFKLEQRPNSDSYGGGS… |
| A0A182G146 | 510-741 | None |
| A0A183NSW2 | 256-500 | None |
| E7FD74 | 901-1168 | None |
| A0A0D8XPP7 | 78-390 | None |
| A0A1I8FF96 | 120-378 | None |
| A0A044T179 | 394-636 | None |
| A0A0N4WCJ0 | 92-362 | None |
| G3NS86 | 291-560 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.