DPCstruct | MC9616
Metacluster Properties and Pfam Annotations
| Number of structural domains | 171 |
|---|---|
| Mean domain length (aa) | 211 ± 38 aa |
| Standard deviation of domain lengths | 38.01 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 80.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 24.90 |
| Pfam Score | 98.40 |
| Assigned Pfam label(s) | CL0125- CL0063- PF05856- CL0188- CL0614 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P7RZM3 | 7-235 | PLESNPDVLNKFIRELGVKEPLRLEDVYGTDPEMQALVPGPVLSLLLLYPLNEETETNPIGTLSPEEKCFFMKQTIHNACGTVAIIH… |
| A0A1R2CBQ5 | 2-194 | TSWPALESDPEIFTNYFRNLGLNSSWEFGEIFTMDEEVEGSALVLVYRSLTADPVFNGQVIEAQYYIKQVEALDNACGLLAGLHSIL… |
| U6N0D1 | 15-265 | None |
| A0A5J4NIT8 | 63-207 | None |
| A0A5N6K6M5 | 127-362 | None |
| A0A7J6YUY5 | 115-334 | None |
| A0A225X0Y9 | 243-460 | None |
| A0A0A2JJN8 | 16-224 | None |
| A0A3Q0KPF2 | 127-334 | None |
| A0A4U1FBM9 | 1-172 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.