DPCstruct | MC9614
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 324 ± 45 aa |
| Standard deviation of domain lengths | 45.41 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 81.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 22.13 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A822CD62 | 62-384 | LSAICDPDLHRKELFGSEGVDLVLQLLKMDPSRFYSGLGHNKLIFCTLDCVWSCIIGCFTSEDYFLEKEGMFIILDLLALNLKSMNN… |
| A0A0R3TZI1 | 21-352 | GTRMIFTYLMCLQTELCDQEHLFNSDWTKPEQLFENWRPLIEMAICVIGAVQSCVANCNENRTLFVQLGGFTILLNILEPLMRCIVT… |
| A0A553MTT3 | 658-1025 | None |
| A0A218V122 | 215-536 | None |
| A0A4W2E9Q7 | 76-367 | None |
| A0A7J6QNM0 | 23-345 | None |
| A0A5K3EZW1 | 225-565 | None |
| E2BAU9 | 17-325 | None |
| A0A1S8VYG9 | 2-257 | None |
| A0A1Y1VFV9 | 854-1137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.