DPCstruct | MC9613
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 240 ± 18 aa |
| Standard deviation of domain lengths | 17.94 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 70.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 32.47 |
| Pfam Score | 91.67 |
| Assigned Pfam label(s) | CL0125- CL0072 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R3TX94 | 1-284 | MHTFQIHWIKEHLDNKVWAFILPEHHSESTVAKEYTIIIQNRIPVPSNTAILKETAYTTELVGSPTVIQITTNATNKELYDVVEKAI… |
| A0A183HCG8 | 140-369 | LPAEEDQSNPQCFIAAPTVIAAHRKMQYNDSYLLGATRGCTARVFGVPLILRFTPGKTTGNKLYEEVWLHVSRFLKNSGVGKQQRIR… |
| A0A1B6FBG0 | 809-1042 | None |
| T1FWA5 | 763-1001 | None |
| A0A672GT52 | 326-556 | None |
| A0A158QYC0 | 547-785 | None |
| E7FCR5 | 1012-1263 | None |
| A0A0N4VWM1 | 1-250 | None |
| G3H9E2 | 462-706 | None |
| A0A6Q2ZHR9 | 433-641 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.