DPCstruct | MC9611
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 98 ± 8 aa |
| Standard deviation of domain lengths | 8.40 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 30.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A433BY42 | 2-109 | ASLLGAVLALSVPVHLNAVDRSGNPIPCGDGLHPTYDAAREQDALNLEQHLNRGAAFLASDYVGQCAALQSHRRTIATPVGAVGVIM… |
| K5BKS1 | 32-134 | AAVVLGIGLLAMAFPVYIDDFDQYGWQIKCGTAYVGDLTQAAASHPPGNPDAETTYVADCESALLFRRLWTVPLVAIAGIVGLIALV… |
| A0A7I7XBA8 | 17-119 | None |
| X8F6T3 | 2-87 | None |
| A0A7I7PB87 | 130-216 | None |
| A0A1A3PLU4 | 12-105 | None |
| A0A7W8CG05 | 2-108 | None |
| A0A7I7YCJ5 | 25-116 | None |
| A0A101AIA1 | 9-102 | None |
| A0A4Q3G6R0 | 11-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.