DPCstruct | MC961
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 122 ± 14 aa |
| Standard deviation of domain lengths | 14.16 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 81.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 39.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V6P693 | 58-170 | YETPMIRAFPYGFNYPIPRGWHYDPVDSQVAEPLPWSEATDDYKELWRGARIVLRLLSQVEKHNVSELRFDSKQLHTGLNFMIFDQP… |
| A0A395RHB8 | 1-136 | MYRTPIIRAFPAGFDYQLPETWPSFDNEKLIDVLPWVSEGKGGDDPYQEVYSDECMAEIYGAKWRGFRLAMRALAEYEDHHITEFVI… |
| A0A1B8AI61 | 200-340 | None |
| A0A366SCK2 | 185-325 | None |
| Q5B2R9 | 194-300 | None |
| A0A395SG48 | 434-548 | None |
| A0A559LIH1 | 4-121 | None |
| T0KGG4 | 258-365 | None |
| A0A0G4PWE9 | 1-126 | None |
| A0A1B8CU64 | 503-608 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.