DPCstruct | MC9609
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 148 ± 17 aa |
| Standard deviation of domain lengths | 17.36 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 93.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 26.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0158 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A433BKD8 | 9-164 | RGQVEDFLRDNGYRNAPITCWFGDFVYIVPYQRSLITGDVDAQARLEDLHVQGAIEGLESHAASARAMFGTDIPHIWMVHGTPLAAR… |
| A4EMH9 | 56-188 | EAAIEILTNLGYQNVPVTIDNDEWQFNADYTEAMADGDTDAAAIIGQNYLAHMQERTSHFQTLAVDELGGDVDHILLVHLNQINADH… |
| A0A2V6Z199 | 6-119 | None |
| A0A2V8M7Y4 | 20-182 | None |
| A0A3S9CQX2 | 2-117 | None |
| A0A840EZ73 | 92-252 | None |
| A0A7Y3HBI9 | 273-446 | None |
| A0A501XPU0 | 171-321 | None |
| A0A2A2SC38 | 524-678 | None |
| A0A2V8ZTX7 | 2-135 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.