DPCstruct | MC9608
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 91 ± 6 aa |
| Standard deviation of domain lengths | 5.53 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 88.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 39.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A151BXX5 | 9-91 | GKVHVVADRCGTCIFRPGDPMRLAPGRVKDMVNAAVSQDSAIICHSSLGGQNAVCRGFFDRYDTTPLRLARALRLVEFDQPAS |
| A0A109B805 | 1-88 | MLSERCATCIFRPGIPFQATSPETVRAMVADAVAGEGHVVCYSTLPGWAPAGVEPVICREYVDAYGHRLLALRFGAALGRLREVPPPA |
| A0A429TP25 | 6-106 | None |
| A0A7K2L5L3 | 7-94 | None |
| A0A542F8F6 | 304-388 | None |
| A0A3N1B2J9 | 147-235 | None |
| A0A853B910 | 160-256 | None |
| A0A089XMF8 | 144-235 | None |
| A0A1C6RKY6 | 243-337 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.