DPCstruct | MC9606
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 92 ± 10 aa |
| Standard deviation of domain lengths | 10.09 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.52 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 33.61 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0013 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0X7JIM9 | 1-100 | MVGLRHTYFPTVGDQNMRGPHPHGYVSLQPGAPLLDVTEMDPSAAWAGGALITTPSDLNRFFGALLGGRLLKPAQLAQVRTTVAIPA… |
| A0A7Y6KU12 | 19-113 | TLRVIRPLKLGGTSFPGVDPKMPKPHPVAYSRLHRTEPDAAIHDATKQNMTWLGAAGDVISTAGDLNRFQRALVAGKLLPRAQTEAM… |
| A0A2T2YWM2 | 55-133 | None |
| A0A2T6KU96 | 125-199 | None |
| A0A6I4Q4X7 | 28-113 | None |
| A0A1I2LBB7 | 1-107 | None |
| A0A7W3LXM8 | 2-94 | None |
| A0A7X0GRM4 | 14-115 | None |
| A0A1G8H260 | 2-88 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.