DPCstruct | MC9603
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 165 ± 11 aa |
| Standard deviation of domain lengths | 11.49 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 75.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 25.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3A8UVM0 | 67-225 | EEEKAKPNRVPEFTRAYVSKAQKYDDLKSSASAFFLVGGLLTAFSVLSWTNMVRLPFGLVGQVSLTALGLIFLAIAAKTSMDAQAVS… |
| A0A352CQ77 | 2-147 | TLTEKAKDLKSSGYTLVLIGGIGLIAMALVLSGAVKLQLEGAFGVIAEVVMTLLFGMFLVSGIRALIRAKTVAMDAVRETGKKEEIK… |
| A0A3C0TEX9 | 153-310 | None |
| V2ZCV2 | 29-202 | None |
| A0A3A8ZMX4 | 6-165 | None |
| A0A351TRR2 | 116-284 | None |
| A0A3D2I368 | 129-291 | None |
| A0A1T5DKA2 | 78-256 | None |
| A0A0K8J499 | 99-292 | None |
| A0A356C4Q4 | 20-181 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.