DPCstruct | MC9601
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 218 ± 40 aa |
| Standard deviation of domain lengths | 39.95 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 69.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 24.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0L7K4N1 | 17-153 | EVLAFITNKIDVMDEESLVRICLSAFKMEEVEKSKNLLFDSITTDIRKIMRKKKSERKTQRDLEDIITVLKSLDPESISIFVAKDLH… |
| A0A0L7LV24 | 128-308 | ALLAFIQNKIDVMSEESIVRICTTSFTTEEIEQAKSLLFESITTTKRKITRKRDGRSQRDLFDVISVFKETDPDETPNFVARMLQRL… |
| R7TRU6 | 9-210 | None |
| T1EUK5 | 11-200 | None |
| T1F3P7 | 2-212 | None |
| A0A7E5VMM0 | 2-247 | None |
| A0A6P8VBV6 | 30-283 | None |
| T1FAB7 | 1-285 | None |
| A0A835L3Z3 | 9-201 | None |
| R7TFL8 | 14-229 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.