DPCstruct | MC9600
Metacluster Properties and Pfam Annotations
| Number of structural domains | 50 |
|---|---|
| Mean domain length (aa) | 173 ± 29 aa |
| Standard deviation of domain lengths | 29.31 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 73.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.59 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 30.66 |
| Pfam Score | 98.33 |
| Assigned Pfam label(s) | CL0361- PF07816 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X0RWY2 | 1-152 | MSAYGSGKANDTDFRRSWNKEEYAAKARAREARDRLAEENEERRKMGLPPLKPKKKEETDEDKEKLSHRTVTLELEKNVGKIQVVQS… |
| A0A0L7LRZ3 | 1-139 | MSLRPDDHRRKWDKDEFEKIAAERLQAELDEDEKSKKKAVPVKRELLKQRDYKVDLDSKLGKSIVINKNTPTAQSGGYYCNVCDCVV… |
| I2H059 | 1-181 | None |
| A0A5J4Z152 | 1-138 | None |
| C4JYD6 | 198-398 | None |
| A0A5N6XMW1 | 517-702 | None |
| A0A0G4H1M7 | 9-190 | None |
| A0A1Q9C5N8 | 181-351 | None |
| A0A1R2CG32 | 9-133 | None |
| A0A7S2CCU5 | 7-172 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.