DPCstruct | MC960
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 68 ± 5 aa |
| Standard deviation of domain lengths | 5.05 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 89.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 40.61 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11324 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M4VYM5 | 8-77 | LKMTGEESSKIQKFLENTLKTPGLALRARPQASDSVEVLVNGEYIGLIHKDLDEGETSYIFTMTILDIDL |
| A0A346A3S7 | 11-76 | IQPIPALNAYLRSRFDNDQIRVVMRPKKTDSLEAYIGEEFLGVLFVENEKGRRSYIFELPILDVDL |
| A0A7C4VJV2 | 20-94 | None |
| A0A5P8MB72 | 1-60 | None |
| A0A7Z7FMT6 | 28-95 | None |
| A0A506UQG0 | 3-72 | None |
| A0A530GWM0 | 1-54 | None |
| A0A3R7RLI2 | 1-66 | None |
| U2WR81 | 1-69 | None |
| A0A1H5Y1N8 | 54-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.