DPCstruct | MC96
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 724 ± 143 aa |
| Standard deviation of domain lengths | 142.61 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 67.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.36 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 23.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0I9R3D2 | 2-596 | YGQQNKMIRCCIIHQLAWHCLYGLPQGTKPNVWERFPPCQAPGPGMPVSQCPVYVDDESPYRFVPPIPSHQDLPHGWFLLQDLINVL… |
| A0A6H5IWA0 | 61-674 | VYSKEIGWKMFVPPLPDHRGYPKGWCLMSDVHLRMPLSMFVKLHNVNSDADGLKELLDHPIKRHMLVKDVPTSLRDILYFKRRYIFS… |
| A0A7E4RJL0 | 106-769 | None |
| A0A4U5N253 | 172-816 | None |
| A0A4U5N1U8 | 53-643 | None |
| A0A453A1M2 | 13-648 | None |
| A0A5N4CXN0 | 163-893 | None |
| Q12789 | 643-1578 | None |
| A0A2R2MK65 | 19-985 | None |
| A0A3L6EUB5 | 17-765 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.