DPCstruct | MC9598
Metacluster Properties and Pfam Annotations
| Number of structural domains | 96 |
|---|---|
| Mean domain length (aa) | 193 ± 45 aa |
| Standard deviation of domain lengths | 44.70 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 86.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 27.54 |
| Pfam Score | 77.85 |
| Assigned Pfam label(s) | CL0023- PF08393 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D2MSI2 | 39-203 | MVSIEGELVPLATRIRPASANGAVEKWLVQVESGMVESMRQVVTQGVAAYAPERRGEWVLKWPGQVVLAVTAIFWTQDVSAAISAGA… |
| A0A0L7LLT6 | 707-922 | TVSFDDKDRIIAINSDNGETIPLDKIVSCMGGVELWLNSLLDSMKDAVRNIIALISQAMASDPEFEFLVAFWHFPGQILWTVDSEYA… |
| A0A1D2MVC0 | 104-259 | None |
| A0A654HM12 | 222-499 | None |
| A0A151HM61 | 664-874 | None |
| A0A086JIU8 | 90-356 | None |
| A0A182T3K7 | 707-945 | None |
| A0A086KKK2 | 2-158 | None |
| A0A1I8FIK3 | 163-356 | None |
| A0A7R9AQ82 | 142-368 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.