DPCstruct | MC9597
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 79 ± 7 aa |
| Standard deviation of domain lengths | 6.65 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 27.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3Q9UXD7 | 1-71 | MSLTIEELDVANHPVQRGPAVPVRVWVRFQEQPVITDAFAIEWNDRAVHVEWSMSDGTKLDAWVWANAVRR |
| A0A2N3FWL3 | 18-96 | GPLQSLTDGQLRLCREVVSIVPDGAEMWGRAWLRFGSVDVRACVRVMRWTSDAVGVEVEVSGDRLRCWVWQGAVEHLAS |
| A0A4U0HJQ2 | 25-98 | None |
| A0A2V5LDX2 | 9-92 | None |
| A0A6M4PBD7 | 35-107 | None |
| A0A1S2GRE3 | 3-80 | None |
| A0A7Y2M0K4 | 4-83 | None |
| D3LLE5 | 4-85 | None |
| A0A1G9ERA1 | 12-90 | None |
| A0A1H1V2J5 | 214-292 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.