DPCstruct | MC9592
Metacluster Properties and Pfam Annotations
| Number of structural domains | 91 |
|---|---|
| Mean domain length (aa) | 88 ± 8 aa |
| Standard deviation of domain lengths | 8.29 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 35.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF17854 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A377NEU1 | 5-89 | WNRMGNLIEARLNDYRIKADVVDKLPGPVITRFELDLAPGVKAARISNLSRDLARSLSAVAVRVVEVIPGKPYVGLELPNKKRQT |
| X1XS13 | 187-249 | LEQTARLVEARLADYRVKAEVVGISPGPVITRFELDLAPGVKAARISNLSRDLARSLSAVAVR |
| A0A3D2C0P7 | 1-104 | None |
| A0A842Q802 | 4-80 | None |
| G6EQE9 | 137-234 | None |
| A0A3M0XLF9 | 47-127 | None |
| A0A1I1ELV7 | 144-239 | None |
| A0A7C2XYG9 | 354-445 | None |
| A0A166UAM8 | 143-223 | None |
| A0A485JHE4 | 2-79 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.