DPCstruct | MC959
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 100 ± 8 aa |
| Standard deviation of domain lengths | 8.42 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 85.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 29.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A127EYG9 | 6-109 | LAVPLTLQFVALAAADTVPNLDVTASCKGAARAVVKADSEKREKACYETEKSARDKLAEKWSSFPDKDRNFCTTSIKSYAPTYTELT… |
| A0A346A281 | 10-112 | ALIAGALMLAGTQVAPAADEVPRFNIGPSCKAAATAAVTASRDEKACTADENTALDKLKQDWSHYNVNQRGHCVRLSSLGGSPSYVE… |
| A0A4P7F2S3 | 15-114 | None |
| A0A4U6BGA3 | 23-107 | None |
| A0A6P1BG21 | 51-138 | None |
| A0A157K9G5 | 18-127 | None |
| A0A7R7BHR6 | 144-249 | None |
| A0A1E3GYV6 | 6-104 | None |
| A0A4P8JXD5 | 1-95 | None |
| A0A1Q4DJR1 | 2-96 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.