DPCstruct | MC9589
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 139 ± 18 aa |
| Standard deviation of domain lengths | 17.79 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 88.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 31.30 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0044 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R6PQG7 | 103-223 | ERRPNAVMPIESHQFVARLIKAIEQSAAKPIDVNRRLSSIKSKLEDWFFSEYEQDITDTFELFYYSGIDDDDPLVLQASSSKGVIHL… |
| A0A1G0NE93 | 283-418 | ARTMPAYRGSVRAGAIAYGGEPGYKGKWRPEVPMPFELHEQASKILQGTSFNDVPIRGANLIDQVRSDLEDWVLAEHPLLMDQRHDI… |
| A0A2K9IHI6 | 216-336 | None |
| A0A0P0DB90 | 226-374 | None |
| A0A7C3R374 | 4-141 | None |
| A0A0Q8KZH6 | 339-483 | None |
| A0A6I4M1H3 | 1-172 | None |
| A0A444K1C3 | 1-113 | None |
| A0A1B4YZU7 | 134-289 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.