DPCstruct | MC9588
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 109 ± 15 aa |
| Standard deviation of domain lengths | 15.17 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 75.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.58 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 41.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F6QWP1 | 1-93 | MECLEGTPGPALWSDGSKEFSQYCFDQLGGEEVLEHESNAGCPAAICGYGTDEHGNPNPTSGEIQTMHGCEAGYITDEELCQAVAEK… |
| A0A6I3KAP2 | 1-107 | MAVEQVPAEPTVVECLEGIPGTARWSDGTVSYSQWCFDTRGGEQYLENERQAGLEETEECVGPAATCGYGTADNGARNPTSGEIQTY… |
| A0A1R4GI21 | 229-329 | None |
| A0A2S8CM42 | 79-199 | None |
| G0HEN3 | 74-208 | None |
| A0A2N6T2B0 | 1-79 | None |
| A0A097IJG2 | 1-123 | None |
| A0A7Y9KNE7 | 165-277 | None |
| A0A6B8W0W2 | 312-419 | None |
| A0A0M4CXH1 | 147-246 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.