DPCstruct | MC9587
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 355 ± 41 aa |
| Standard deviation of domain lengths | 40.73 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 14.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A844MTH1 | 8-396 | TQQWCLDYEAASAKDKHLLMVEALNNPIPSKAIEECDLGMLLVELVDEMVSNNLISDALALMEKVQRQQPELYAREFQYLDSLRVKY… |
| A0A1W9Q3A0 | 12-390 | ESEKENPGQSGVLDLFDNSKLDKKLFIFSKMQEADVLDAEYAFEFLTTIKSDFDAKTKDGRSGYAALLNKLRDEKPDVFEHDSHYYN… |
| A0A1V5UQ58 | 401-778 | None |
| A0A256WDB7 | 4-283 | None |
| A0A1F8U7K6 | 1-402 | None |
| B0TB38 | 348-690 | None |
| A0A084SX01 | 95-460 | None |
| A0A143B475 | 42-436 | None |
| A0A2E0ZNI9 | 16-298 | None |
| A0A098RXE9 | 14-337 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.