DPCstruct | MC9586
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 113 ± 6 aa |
| Standard deviation of domain lengths | 6.06 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 80.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 46.96 |
| Pfam Score | 33.33 |
| Assigned Pfam label(s) | CL0344- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A430KWY6 | 48-163 | LDVQQKLAILADAAKYDASCASSGSVKRTSRDGKGLGSTDQGMGICHAYAPDGRCISLLKILLTNSCIFDCHYCINRKSSNVRRARF… |
| A0A1W9PRQ7 | 1-120 | MNDYARLRHLTSQMHLEAAEDVGCLSLPTQAQGSVNVSSATLPNGGRIKLLKTLLSSVCERNCYYCPFRSERNYQRVSFRPEDFAAL… |
| A0A7V5TNN4 | 280-392 | None |
| A0A7Y9IRB6 | 1-113 | None |
| A0A7V8AG99 | 1-109 | None |
| A0A3R6JTW5 | 6-117 | None |
| A0A2A2K6X9 | 174-287 | None |
| A0A349UMR0 | 100-207 | None |
| A0A7C4HDQ0 | 175-291 | None |
| A0A165LZJ3 | 1-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.