DPCstruct | MC9584
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 92 ± 15 aa |
| Standard deviation of domain lengths | 14.58 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 86.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 30.17 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A397NK76 | 13-104 | DTLTAREAYQVLRDIALGIRVMRRVDRSPQPNYGLMTIEVDGWVVRLYSEDEELDYCDSCHCPDGRAYAFSALQYFGTDPLELLSTW… |
| A0A5E7VLS8 | 2-88 | LTDVALGKRIMTRSSTQSWSEIYHGLMPVEIDGWQLTLFNDCHTLDYCEYCRSPDGRVGTLELWQREGADPVELLSAWEREQLERLL |
| A0A511T047 | 126-233 | None |
| A0A5E7QB67 | 3-95 | None |
| A0A533BGA4 | 7-94 | None |
| A0A2V9BUA9 | 1-77 | None |
| A0A383RQ63 | 1-78 | None |
| A0A5E7JU34 | 1-64 | None |
| J3HFI6 | 42-135 | None |
| A0A5B8Y0Q5 | 2-96 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.