DPCstruct | MC958
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 93 ± 10 aa |
| Standard deviation of domain lengths | 10.04 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 83.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 24.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06411 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A023XPU0 | 1-76 | MDSKGFINVQALTCAQLANTYQEDADYLAAWYSGWYNGLAQKHFAHVTRAKSGEHQVIVYCKAHPELKVIQAIDVL |
| A0A345ZRZ5 | 3-102 | RRAMLRTILIAGAVMAGAVSMPATAQVNLDMNQITCGDWLGYDQTSREFVGYWMSGYYSATRNDNVLDFRRLKQNAEKVAAYCKKHK… |
| A0A0P8AB27 | 1-110 | None |
| A0A2T5B817 | 16-94 | None |
| A0A431M6B5 | 44-136 | None |
| A0A6B8K9M0 | 3-94 | None |
| A0A7S7QN01 | 5-98 | None |
| A0A6N8BPQ7 | 36-136 | None |
| A0A845IF15 | 152-257 | None |
| A0A4D7AXF6 | 11-94 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.