DPCstruct | MC9577
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 341 ± 44 aa |
| Standard deviation of domain lengths | 43.59 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 24.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1L6LHZ7 | 13-288 | LVTLRAPWSTANLSFFGLEVVVVICGVLSLLHALRARERGDGLPLFTWGVSFTYGLVMEIGSYNFLESFKHGQFAVMFYKHQLPLYV… |
| A0A2G5SL41 | 37-436 | DWICKYQEVSKIYENHTSFLFGEILFFILAGLTFAHAWRSGTRFVLVWFGILIHALNVENLCYWIPDMDNFWQAQGILTFFGARAPL… |
| A0A194QLW0 | 566-961 | None |
| A0A3F2RRM0 | 511-889 | None |
| A0A0B2VYZ7 | 43-417 | None |
| A0A7R9JCF2 | 382-698 | None |
| A0A401SHS8 | 90-479 | None |
| A0A444SFA0 | 32-353 | None |
| A0A6N3C1H6 | 6-300 | None |
| A0A044SLY4 | 37-436 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.