DPCstruct | MC9574
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 97 ± 8 aa |
| Standard deviation of domain lengths | 8.00 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 82.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 43.70 |
| Pfam Score | 86.19 |
| Assigned Pfam label(s) | CL0123- PF04236- CL0271 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G5SJ04 | 7-93 | PIKRNHYYLKACILYEVLQKKPIFESYRNFCDTVGQDGMEYPDFEYWYYRFYHGQMDFDYDRSADPMPKTLVDIPVVSMKKIAESLD |
| A0A2G5SI91 | 1-94 | MASKLDKATRNDPKTRATFIYYEFQSGKQIFECFKKFCERMGPDYVDYQEFEFWWQRFSAGKFDLDYDRSQEPKYRTISDMPVNIFQ… |
| G0PJ62 | 2-85 | None |
| G0NN07 | 278-363 | None |
| G0NID3 | 67-172 | None |
| G0N307 | 29-126 | None |
| B6VBP7 | 67-179 | None |
| A0A6A5GHG7 | 736-840 | None |
| A0A2G5SIN4 | 1-99 | None |
| A0A2G5SIP5 | 1-95 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.