DPCstruct | MC957
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 80 ± 8 aa |
| Standard deviation of domain lengths | 8.43 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 29.77 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0057 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A5H3X7 | 13-91 | ASIFVSINELKKMNIIINGKRTSITLEPQIWNILQEVSAEQNCDVHELCSFIHDRKNPESSLTSAIRVFLISYLNIQLK |
| A0A345ZQN6 | 2-78 | QPVVHKRSVIIGGHKTSISLEEAFWREVRAIADSRRMTVSALLREIDEARRTPNLSSAIRVYVLEHVRAQADAAHPR |
| G6A0J4 | 9-89 | None |
| A0A2E0M365 | 7-73 | None |
| A0A7C9GFU6 | 2-82 | None |
| A0A2N6AW21 | 102-179 | None |
| A0A521GNK4 | 2-86 | None |
| A0A2S2CMT8 | 2-70 | None |
| A0A2E0M022 | 4-85 | None |
| A0A1X7P3D3 | 23-103 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.