DPCstruct | MC9569
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 210 ± 19 aa |
| Standard deviation of domain lengths | 18.67 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 77.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 24.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6S7KCF4 | 1-210 | MSDIPISDPNLQRKLSIESLSLAYAKKSAVKEVIFAVSIPYPLLKAWYNIVSTSNYTGKFAYTELLESCIPGHSFAITSEEAVRLHV… |
| A0A7D9KDM4 | 1-236 | MSDIPLNDSILKWKLCMEEPSLAYAAKPNARPVLFVVGIPYPLLKVWQEYMVKQNEMQKIAEEDRAGENENTCPCQDNLDYVDLFEL… |
| A0A6S7LLK6 | 9-212 | None |
| A0A7D9LAE6 | 1-228 | None |
| A0A6S7IDP2 | 10-210 | None |
| A0A7D9DFL5 | 1-226 | None |
| A0A6S7IX30 | 8-189 | None |
| A0A7D9IZ00 | 1-219 | None |
| A0A8B6G6L9 | 13-187 | None |
| A0A7D9JBZ0 | 1-215 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.