DPCstruct | MC9568
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 65 ± 8 aa |
| Standard deviation of domain lengths | 8.39 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 71.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 73.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03299 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7D9KCU6 | 8-70 | DDSKDEIDTSLPVQPSDVFCSVPGRLSLLSSTSKYKVTVGEIRRRLSHPECLNASLLGGVLRR |
| A0A0K0DBC5 | 6-52 | QVYCTVPGRTSLLSSTTKYRVTVGEIQRRISPPECLNASLLGGILRR |
| A0A7J7FP83 | 1-53 | None |
| T1EGY7 | 1-54 | None |
| A0A0K0DWA0 | 598-664 | None |
| A0A0K0EEJ1 | 274-341 | None |
| A0A5A9MRI7 | 209-282 | None |
| A0A4Z2E6W0 | 2-55 | None |
| A0A821RKJ9 | 12-73 | None |
| A0A2I0TAY6 | 123-188 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.