DPCstruct | MC9563
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 184 ± 19 aa |
| Standard deviation of domain lengths | 18.74 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 80.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 24.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5E4BY28 | 48-221 | PQKSVVHCSKIWSCRKKITVEYLQHVVEQKNGKEVVPVLWQFLQKEAELRLVKFLPEILALQRDLVKRFQNVPEDEYCSIRSFISSH… |
| A0A7D9JNF2 | 1-199 | MRLVHELDGPNYESITKLDPMCPALWRYRKKIAIENVSFKFQEYAQGCDKLERCEILAEFLKKEQHLRALQYLPDIIKLQRLLFEKF… |
| A0A2N0NW72 | 10-178 | None |
| A0A2N1M167 | 1-195 | None |
| A0A7S4PYC2 | 147-316 | None |
| A0A7S4DNC7 | 155-324 | None |
| A0A812WBD0 | 166-379 | None |
| A0A7S0H2D3 | 220-413 | None |
| A0A7S2DYE6 | 88-250 | None |
| A0A813LL23 | 15-201 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.