DPCstruct | MC9560
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 73 ± 5 aa |
| Standard deviation of domain lengths | 4.80 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 89.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 38.32 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W5YUV0 | 1-68 | MPLIINDDPELARRCGAAGVHLGQSDGSLALARRQLGDHAIVGATCHADLALASRADADGADYLARPL |
| A0A8B2E305 | 1-80 | MTQDHGIPYFIDYDVDLALQVHVDGVHVGQKDEGIQSVLDQAAGKLIVGYSCNTPEEVVEAHKLSGVDCLGRGTGLPNEF |
| M7T4E0 | 560-634 | None |
| A0A137Q490 | 37-102 | None |
| A0A3E3HZW5 | 67-144 | None |
| A0A2E3RQW4 | 320-389 | None |
| A0A6N6RNL9 | 1-72 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.