DPCstruct | MC956
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 252 ± 30 aa |
| Standard deviation of domain lengths | 29.68 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 89.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 16.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X5MEM8 | 55-321 | PIIQEMRRHMKVNVTLFKNVDLSNPIAAHHKAWTLGIEQARASKSLIMLLPPDVAWSQNAFKTVGEKLVEGYQAIFMTYLRAEDRTF… |
| A0A3B1CMG9 | 244-478 | HRSAVRSASGQNTALIFLSPDTVISEKALERVCNVVYSGKRVIMVVGLSVSKEAFLSEFIKRFHNADGHFPAPSRPIVELALKCLHP… |
| A0A1G9B6U7 | 234-466 | None |
| A0A7Y0E3T3 | 90-344 | None |
| A0A537J8B3 | 19-333 | None |
| A0A0X8JLU9 | 343-589 | None |
| A0A3B0Y6G4 | 109-333 | None |
| A0A1G0X724 | 110-409 | None |
| A0A2G2A0W6 | 184-399 | None |
| A0A2D7IGC2 | 92-321 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.