DPCstruct | MC9558
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 49 ± 1 aa |
| Standard deviation of domain lengths | 1.35 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 66.36 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 85.68 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A139PYL8 | 1-50 | MKIKEQTRKLAAGCSKQCFEVVDRTDEVSNHTYGKVKLTWFEEIFEEYKM |
| A0A1X1J9B1 | 1-50 | MKIKEQTRKLAAGCSKHCFEVIDKTDEVSNHTFGKATLTWFEEIFEEYNA |
| A0A828TI09 | 1-48 | None |
| V8I737 | 1-51 | None |
| A0A1S1CS24 | 1-50 | None |
| A0A139Q4W5 | 1-48 | None |
| A0A7U0IMQ3 | 1-47 | None |
| E9FK83 | 1-50 | None |
| A0A1E8ZT62 | 1-49 | None |
| A0A1F0N939 | 1-50 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.