DPCstruct | MC9557
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 106 ± 11 aa |
| Standard deviation of domain lengths | 11.24 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 75.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 22.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A139WZ84 | 1-95 | MSNNFLVQNKSSSSINSIDELEQALRVILKSLINQSQEGYVIQGILGGELHKRYGEGINKMLKRLQFDGNFTQFLEFSKSVKLDKTE… |
| A0A6H2NL12 | 13-120 | LKGPATAESPTDQSIKSSVPKDAPQKITDARTLEQALVKLLWSLPSKQTGGQVSLSVVGTQFAVVHREPLSKVLKRIGEPKGLPKFL… |
| A0A845WDA7 | 199-305 | None |
| A0A2T1DC15 | 102-233 | None |
| A0A6P2AWV4 | 44-158 | None |
| A0A6M8BHX1 | 1-128 | None |
| A0A7C9TW09 | 453-547 | None |
| A0A2S6V3V1 | 77-172 | None |
| A0A846DX02 | 143-246 | None |
| A0A7C3VNE1 | 371-469 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.