DPCstruct | MC9555
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 627 ± 68 aa |
| Standard deviation of domain lengths | 68.21 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 90.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 19.55 |
| Pfam Score | 75.00 |
| Assigned Pfam label(s) | CL0020- CL0103 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3S9PPB6 | 1-622 | MATTIRRAVLTLPAASPGPENPLPRLGTRGDVHRLDRAAMAALPPAMARRTRYAPPRSLLPVRRRDDYTRTRVPTDLDAIVIENDRL… |
| A0A7C5IG19 | 2-508 | SELKLETYIMPSAALGKENPLPVLDECLPYTLQDGYNRTRKNRSFKTVVLENETLKATFLIELGGRLWSLYHKKKKRELLYVNPVFQ… |
| A0A1Q4GBT1 | 29-632 | None |
| A0A2W6BJD7 | 2-531 | None |
| A0A1G6TCN2 | 19-716 | None |
| A0A7C4EE01 | 192-902 | None |
| A0A831LQ71 | 21-644 | None |
| A0A7G8Q1I0 | 1-655 | None |
| A0A0S7YL90 | 2-696 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.