DPCstruct | MC9554
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 121 ± 15 aa |
| Standard deviation of domain lengths | 15.41 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.18 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 31.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A510TIB2 | 83-228 | QRCGRGMSVEVSPNSGEDMAAPPPHEAYADAPDLRREMHQVLALGAERDGRRARSVIGPPVDATAAERAWLLRRAALMDRMALDDPG… |
| A0A2A2D943 | 7-120 | GAGFDAPPPEVAYMGVTNLTAQIHAFMTRTANNPPDEDDPAKYREFLLHRAALADLAHLEELDNEEAHTYAVKASQDFIRYDRQHPE… |
| A0A1H9XDR5 | 47-139 | None |
| A0A5P2CK54 | 2-115 | None |
| A0A6I7YWU3 | 104-217 | None |
| A0A100JFT1 | 168-295 | None |
| A0A7X0LSV5 | 2-108 | None |
| A0A397NPB4 | 4-106 | None |
| A0A1Y2NGR1 | 141-245 | None |
| A0A559TRP3 | 38-182 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.