DPCstruct | MC9553
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 171 ± 24 aa |
| Standard deviation of domain lengths | 24.43 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 84.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 32.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A830H5I9 | 4-145 | ASKTGWASPNWNWGYAVGDAHDLAMTTRSKLRTENARKTFLANLAAGSVDLEEVKMVFALTVQLANHRRQAGPLNDVLMRMAAVSYE… |
| A0A7S4J9U7 | 28-239 | SSIPLPLLHSSRTSISSNRFCSRLMSSTSPDGEATVRGEIYAVPGSGWASPDWNWGYASGTGHDCAMICRRRWSAADSRAALVEALL… |
| A0A7S2HTA3 | 33-205 | None |
| A0A7S1NBJ9 | 103-285 | None |
| D8LBK5 | 23-209 | None |
| A0A5B8MH75 | 2-126 | None |
| A0A1E7FX35 | 5-186 | None |
| A0A7S3DVV8 | 2-142 | None |
| A0A7S1TPS1 | 54-232 | None |
| A0A7S4W8J9 | 1-191 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.