DPCstruct | MC9550
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 158 ± 13 aa |
| Standard deviation of domain lengths | 13.27 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 75.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 58.67 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0229 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S4EQJ0 | 586-748 | KWRRLRGIVDERKLPPKWYCTMNKNDPERARCSAPEEEYEASHTPESAADARTRKHLRVWVRRLQCNEQYESRLPTLTRGKKRSVAS… |
| A0A7S4IG23 | 1-169 | MTRRPHFQWRRLRGVVDAKKLPSKWYCHMNKNDPDRAKCSAPEEEYETPTTPESASDQRTRKHLRLWVRRLQCNEAYESRLPTMTRG… |
| K0S7S8 | 140-269 | None |
| A0A482SCH5 | 115-277 | None |
| A0A7S2MP46 | 64-225 | None |
| A0A7R9WS73 | 1-136 | None |
| A0A1E7FWZ7 | 488-650 | None |
| A0A1Z5K035 | 232-386 | None |
| A0A7S2B7X4 | 1-174 | None |
| A0A7S4MKU7 | 378-539 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.