DPCstruct | MC955
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 101 ± 9 aa |
| Standard deviation of domain lengths | 8.99 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 51.54 |
| Pfam Score | 95.45 |
| Assigned Pfam label(s) | CL0007- CL0021 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y1LQ80 | 2-81 | MRQYLQEGDLISAEVQNVFSDGSLSLHTRSFKYGKLSQGVMLKVFPSLIKRSKTHFHDLPIGASVILGNNGFVWISPTMV |
| A0A6P4J9T6 | 1-91 | MLLRLSVNLPGGELRRRSAEDEVQNIFEEGTLSLYTRSLKYGKLSQGILIKVFAALVKRRKMHFHNLPCGASVILGNNGYIWIAPTK… |
| A0A507C7N6 | 103-210 | None |
| A0A0V0S8H8 | 105-210 | None |
| A3KFL1 | 109-196 | None |
| A0A1B2J8R1 | 123-225 | None |
| U4UH27 | 558-663 | None |
| A0A565ALU1 | 122-223 | None |
| A0A565BL38 | 43-143 | None |
| A0A2A2KH05 | 121-225 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.