DPCstruct | MC9545
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 213 ± 15 aa |
| Standard deviation of domain lengths | 14.94 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 82.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 28.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5B8MBN1 | 2-215 | VAASATDDHDEDHHKCACEARKYGVSISCTSLNVMLVEKAIEHLQLPSNNCNATKNACPGHFFLLQAHHDFCPHDVLPAAAEKLIHD… |
| A0A6U6G742 | 164-381 | HSHSHGDHEETSGKSCACAAKEYKFNIDCTATAAMLDAMAFLKNAGCASDCSPTACETNYLIVQAHHDYCPEDKIPQEVEDGFHDYD… |
| A0A7S3E667 | 89-309 | None |
| A0A7S0BYI5 | 14-199 | None |
| A0A7S3ZCF2 | 33-229 | None |
| C1EDL9 | 38-266 | None |
| A0A7S3UH34 | 52-261 | None |
| A0A7S3F9U8 | 1-230 | None |
| A0A7S0IWM6 | 32-255 | None |
| A0A7S2TKI8 | 130-320 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.