DPCstruct | MC9543
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 122 ± 6 aa |
| Standard deviation of domain lengths | 5.83 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 92.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 34.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D4ZI20 | 5-125 | DNLVSLGFKFGKNGAHSARSMMIEELSLLFLSCSENATQVDFEKDIVDFNILHKPTEKSRKLTFRHLVDLYSLDLDVPLFNVLRQWW… |
| M2ACY0 | 16-141 | LERFGFAMNAGGPHLARSMMLSDLVTLLSDNRLEQSRSKLLDAIEDENVLGKRTTRSRKLAARHMGALYGLDLDVPLYRDFVYLWQR… |
| A0A250L8P3 | 1-111 | None |
| A0A4R2YFI1 | 1-132 | None |
| A0A7W3WCQ7 | 8-125 | None |
| A0A841I4M3 | 1-127 | None |
| A0A1E4PRB7 | 2-128 | None |
| A0A832W4S6 | 45-168 | None |
| A0A2M7L1A2 | 8-125 | None |
| H1Z0U4 | 29-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.